Structure of PDB 7yf2 Chain B

Receptor sequence

>7yf2B (length=268) Species: 9606 (Homo sapiens)

KENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWAAIQAY
HSAVSSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLL
DLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTG
FQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN
VGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGD
MYNDYYVLDDAVFVLKPV

3D structure

• PDB: 7yf2 Molecular basis for METTL9-mediated N1-histidine methylation
• Chain: B
• Resolution: 1.691 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	S105 R123 G124 M126 N210 D213 R214 V241 P243 H245 Y247 Q267 N268 W269 Q272 Y295 C297 D300 Y302 Y306 L308	S55 R73 G74 M76 N160 D163 R164 V191 P193 H195 Y197 Q217 N218 W219 Q222 Y245 C247 D250 Y252 Y256 L258
BS02	SAH	B	G153 E174 L175 I193 L209 N210 L211 Y295	G103 E124 L125 I143 L159 N160 L161 Y245

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0106370 protein-L-histidine N-pros-methyltransferase activity

Biological Process

• GO:0032259 methylation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum

External links

• PDB: RCSB:7yf2, PDBe:7yf2, PDBj:7yf2
• PDBsum: 7yf2
• PubMed: 37015930
• UniProt: Q9H1A3|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)