Structure of PDB 7y9c Chain B

Receptor sequence

>7y9cB (length=265) Species: 9606 (Homo sapiens)

HQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWAAIQAYHSA
VSSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLG
AGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQY
DVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGG
KWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYN
DYYVLDDAVFVLKPV

3D structure

• PDB: 7y9c Molecular basis for METTL9-mediated N1-histidine methylation
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	S105 N118 R123 G124 M126 N210 D213 R214 V241 L242 P243 H245 Y247 Q267 N268 W269 Q272 Y295 C297 D300 Y302 Y306 L308	S52 N65 R70 G71 M73 N157 D160 R161 V188 L189 P190 H192 Y194 Q214 N215 W216 Q219 Y242 C244 D247 Y249 Y253 L255
BS02	SAH	B	G153 E174 L175 I193 L209 N210 L211 Y295	G100 E121 L122 I140 L156 N157 L158 Y242

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0106370 protein-L-histidine N-pros-methyltransferase activity

Biological Process

• GO:0032259 methylation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum

External links

• PDB: RCSB:7y9c, PDBe:7y9c, PDBj:7y9c
• PDBsum: 7y9c
• PubMed: 37015930
• UniProt: Q9H1A3|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)