Structure of PDB 7xxk Chain B |
>7xxkB (length=107) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
PRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQF APSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHI DAYKTFP |
|
PDB | 7xxk Crystal structure of SARS-CoV-2 N-CTD in complex with GMP |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5GP |
B |
R259 W330 |
R2 W73 |
|
|
|
|