Structure of PDB 7xpl Chain B

Receptor sequence

>7xplB (length=375) Species: 2287 (Saccharolobus solfataricus)

KIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATV
ELLKKVNPQEVVVENEAEVPKLQALGYRVSYEPYSKVSRIFRESLPKVAI
DIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDK
TINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKE
LGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNN
YLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEK
ALFRALRSGGRPPKHGIIFQYPAIHTSPRWQRGKIARALAAKLAIAARVD
AFSGRFIGDQLNEQLKKRIDEIKEK

3D structure

• PDB: 7xpl Methylation guide RNAs without box C/D motifs.
• Chain: B
• Resolution: 2.213 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	K152 E159 R160 Q296 G299 A300 K302 A303 R306 R313 P314 P315 K316 H317 G318 F321 R331 K336 R339	K150 E157 R158 Q294 G297 A298 K300 A301 R304 R311 P312 P313 K314 H315 G316 F319 R329 K334 R337
BS02	rna	B	R145 L304 F305 L308	R143 L302 F303 L306
BS03	rna	B	N155 E159 H179 R276 F321 Q322 H327	N153 E157 H177 R274 F319 Q320 H325

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0030515 snoRNA binding

Cellular Component

• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome

External links

• PDB: RCSB:7xpl, PDBe:7xpl, PDBj:7xpl
• PDBsum: 7xpl
• PubMed: 36127125
• UniProt: Q97ZH3