Structure of PDB 7xmw Chain B |
>7xmwB (length=72) Species: 888055 (Leptotrichia wadei F0279) [Search protein sequence] |
HHHHHAMWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDF SCAKCDNSSSKIQEIAYWDEIN |
|
PDB | 7xmw Structure of AcrVIA2 and its binding mechanism to CRISPR-Cas13a. |
Chain | B |
Resolution | 2.59 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C4 C7 C46 C49 |
C10 C13 C52 C55 |
|
|
|