Structure of PDB 7xlz Chain B

Receptor sequence
>7xlzB (length=246) Species: 882102 (Vibrio anguillarum 775) [Search protein sequence]
RSFYPLTVADSQQISPSLQRITLQGDSIGHFTLENEGDYIKLLFSEDGGT
DRQIMRTYTIRSFDATNNRIEIDFVRHEAEDKQCGFAVRWAMHTAIGDTI
SIAGPGKAQGLNPNGKWFFLAADMTAIPALAAQLKRLPRDAKGYAVIEIE
HVDDKQALQAPENIEISWVVKDSSTNLATSVIEKNWLGENGSVWCACEFD
TMRALREYFRNEKEIAKDYIYISSYWKRGVSEDGHKQLKQTDAQTQ
3D structure
PDB7xlz Structure of siderophore-interacting protein from Vibrio anguillarum
ChainB
Resolution1.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FAD B R72 T73 Y74 T75 D89 V91 H93 G101 A103 V104 T141 Y241 W242 K243 R244 G245 V246 S247 E248 R56 T57 Y58 T59 D73 V75 H77 G85 A87 V88 T125 Y225 W226 K227 R228 G229 V230 S231 E232
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Nov 27 04:49:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7xlz', asym_id = 'B', title = 'Structure of siderophore-interacting protein from Vibrio anguillarum'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7xlz', asym_id='B', title='Structure of siderophore-interacting protein from Vibrio anguillarum')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '7xlz', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='7xlz', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>