Structure of PDB 7xk3 Chain B

Receptor sequence

>7xk3B (length=387) Species: 345073 (Vibrio cholerae O395)

YEAAATLFYTPGLVTKRSSHVRDSVDLKRIMIMVWLAVFPAMFWGMYNAG
GQAIAALNHLYSGDQLAAIVAGNWHYWLTEMLGGTMSSDAGWGSKMLLGA
TYFLPIYATVFIVGGFWEVLFCMVRKHEVNEGFFVTSILFALIVPPTLPL
WQAALGITFGVVVAKEVFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVW
TAADGYSGATALSQWAQGGAGALINNATGQTITWMDAFIGNIPGSIGEVS
TLALMIGAAFIVYMGIASWRIIGGVMIGMILLSTLFNVIGSDTNAMFNMP
WHWHLVLGGFAFGMFFMATDPVSASFTNSGKWAYGILIGVMCVLIRVVNP
AYPEGMMLAILFANLFAPLFDHVVVERNIKRRLARYG

3D structure

• PDB: 7xk3 Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
• Chain: B
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	B	R209 F213 W226 T236 S271 E274 P379 E380 G381 M383	R183 F187 W200 T210 S245 E248 P353 E354 G355 M357
BS02	RBF	B	V60 T162 L165 N200 N203 P204 A205 I292 F342 M343 T345 D346 P347 V348	V34 T136 L139 N174 N177 P178 A179 I266 F316 M317 T319 D320 P321 V322
BS03	FMN	B	F213 P217 A377	F187 P191 A351

Gene Ontology

Molecular Function

• GO:0010181 FMN binding
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:1902444 riboflavin binding

Biological Process

• GO:0006814 sodium ion transport
• GO:0022904 respiratory electron transport chain
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:7xk3, PDBe:7xk3, PDBj:7xk3
• PDBsum: 7xk3
• PubMed: 35882843
• UniProt: A5F5X0|NQRB_VIBC3 Na(+)-translocating NADH-quinone reductase subunit B (Gene Name=nqrB)