Structure of PDB 7xjo Chain B

Receptor sequence

>7xjoB (length=165) Species: 9606 (Homo sapiens)

NFFPRKPKWDKNQITYRIIGYTPDLAPETVDDAFARAFQVWSDVTPLRFS
RIYDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDD
ELWTLGKGVGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLS
QDDIKGIQELYGASP

3D structure

• PDB: 7xjo Discovery of Aryloxyphenyl-Heptapeptide Hybrids as Potent and Selective Matrix Metalloproteinase-2 Inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.24: gelatinase A.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	P6 L82 L83 H85 A86 F87 A88 H121 H125 E130 H131 L138 A140 I142 T144	P4 L80 L81 H83 A84 F85 A86 H119 H123 E128 H129 L136 A138 I140 T142
BS02	CA	B	R67 E69	R65 E67
BS03	ZN	B	H121 H125 H131	H119 H123 H129
BS04	ZN	B	H70 D72 H85 H98	H68 D70 H83 H96
BS05	CA	B	D77 G78 D80 L82 D100 E103	D75 G76 D78 L80 D98 E101
BS06	CA	B	D60 G92 G94 D96	D58 G90 G92 D94
BS07	CA	B	T24 D26 D101 E103 W105	T22 D24 D99 E101 W103

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:7xjo, PDBe:7xjo, PDBj:7xjo
• PDBsum: 7xjo
• PubMed: 35687819
• UniProt: P08253|MMP2_HUMAN 72 kDa type IV collagenase (Gene Name=MMP2)