Structure of PDB 7xbk Chain B

Receptor sequence

>7xbkB (length=351) Species: 9606 (Homo sapiens)

KREAEERRRFPLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVF
LFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSP
PGYVGHEEGGQLTKKLKQCPNAVVLFDQVDKAHPDVLTIMLQLFDEGRLT
DGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGD
VQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELI
QLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVE
RRVVNQLAAAYEQDLLPGGCTLRITVEDSDKQLPKLRLEIIDKDSKTRRL
D

3D structure

• PDB: 7xbk Comprehensive structural characterization of the human AAA+ disaggregase CLPB in the apo- and substrate-bound states reveals a unique mode of action driven by oligomerization.
• Chain: B
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	G399 Y400 V401	G102 Y103 V104
BS02	ATP	B	I317 I318 S353 G354 I355 G356 K357 T358 E359 Q425 N466 F541 K552 R590	I20 I21 S56 G57 I58 G59 K60 T61 E62 Q128 N169 F244 K255 R293

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0140545 ATP-dependent protein disaggregase activity

Biological Process

• GO:0030851 granulocyte differentiation
• GO:0034605 cellular response to heat
• GO:0039529 RIG-I signaling pathway
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:7xbk, PDBe:7xbk, PDBj:7xbk
• PDBsum: 7xbk
• PubMed: 36745679
• UniProt: Q9H078|CLPB_HUMAN Mitochondrial disaggregase (Gene Name=CLPB)