Structure of PDB 7x0z Chain B

Receptor sequence
>7x0zB (length=580) Species: 9606 (Homo sapiens) [Search protein sequence]
KAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVAR
LDGRLARCIVRKDPRAFGWQLLQWLLIALPATFVNSAIRYLEGQLALSFR
SRLVAHAYRLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYS
NLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTANVLRAFSP
KFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHEVELALLQRSYQDL
ASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITAVSERTEAFT
IARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKR
PVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLI
TGPNGCGKSSLFRILGGLWPTYGGVLYKPPPQRMFYIPQRPYMSVGSLRD
QVIYPDSVEDMQRKGYSEQDLEAILDVVHLHHILQREGGWEAMCDWKDVL
SGGEKQRIGMARMFYHRPKYALLDQCTSAVSIDVEGKIFQAAKDAGIALL
SITHRPSLWKYHTHLLQFDGEGGWKFEKLD
3D structure
PDB7x0z Structural insights into substrate recognition and translocation of human peroxisomal ABC transporter ALDP.
ChainB
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.2.-
7.6.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B R591 V604 S606 G607 G608 E609 R486 V499 S501 G502 G503 E504
BS02 MG B S514 Q544 S409 Q439
BS03 ATP B P484 N509 G510 G512 K513 S514 S515 Q544 P379 N404 G405 G407 K408 S409 S410 Q439
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0015607 ABC-type fatty-acyl-CoA transporter activity
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0019899 enzyme binding
GO:0042626 ATPase-coupled transmembrane transporter activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043531 ADP binding
GO:0046982 protein heterodimerization activity
GO:0047617 fatty acyl-CoA hydrolase activity
GO:0052817 very long-chain fatty acyl-CoA hydrolase activity
GO:0140359 ABC-type transporter activity
Biological Process
GO:0000038 very long-chain fatty acid metabolic process
GO:0002082 regulation of oxidative phosphorylation
GO:0006635 fatty acid beta-oxidation
GO:0007031 peroxisome organization
GO:0015910 long-chain fatty acid import into peroxisome
GO:0015916 fatty-acyl-CoA transport
GO:0015919 peroxisomal membrane transport
GO:0030497 fatty acid elongation
GO:0031998 regulation of fatty acid beta-oxidation
GO:0032000 positive regulation of fatty acid beta-oxidation
GO:0036109 alpha-linolenic acid metabolic process
GO:0036113 very long-chain fatty-acyl-CoA catabolic process
GO:0042758 long-chain fatty acid catabolic process
GO:0042760 very long-chain fatty acid catabolic process
GO:0043217 myelin maintenance
GO:0043651 linoleic acid metabolic process
GO:0051900 regulation of mitochondrial depolarization
GO:0055085 transmembrane transport
GO:0055089 fatty acid homeostasis
GO:0055092 sterol homeostasis
GO:1900016 negative regulation of cytokine production involved in inflammatory response
GO:1900407 regulation of cellular response to oxidative stress
GO:1903427 negative regulation of reactive oxygen species biosynthetic process
GO:1990535 neuron projection maintenance
GO:2001280 positive regulation of unsaturated fatty acid biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005777 peroxisome
GO:0005778 peroxisomal membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7x0z, PDBe:7x0z, PDBj:7x0z
PDBsum7x0z
PubMed36810450
UniProtP33897|ABCD1_HUMAN ATP-binding cassette sub-family D member 1 (Gene Name=ABCD1)

[Back to BioLiP]