Structure of PDB 7wb3 Chain B

Receptor sequence

>7wb3B (length=203) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence]

IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYF
GEFGKRGVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMK
EKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVP
AEHAQEIAERLEKAGIKGILNFAPVKIKVSVPVENIDITASLRVLTFEIV
RRN

3D structure

PDB

7wb3 Structural Basis of Redox-Sensing Transcriptional Repressor Rex with Cofactor NAD + and Operator DNA.

Chain

Resolution

2.401 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	P6 K7 P8 R12 R60	P2 K3 P4 R8 R56
BS02	dna	B	S32 S33 R48 K49 E56 G58 R60 G61 V62 G63 Y64	S28 S29 R44 K45 E52 G54 R56 G57 V58 G59 Y60
BS03	NAD	B	G91 N92 I93 D115 S116 K120 V134 A152 V153 P154 I161 F176 A177 P178 I192	G87 N88 I89 D111 S112 K116 V130 A148 V149 P150 I157 F172 A173 P174 I188

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0051775	response to redox state

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7wb3, PDBe:7wb3, PDBj:7wb3
PDBsum	7wb3
PubMed	35163512
UniProt	Q9WY16\|REX1_THEMA Redox-sensing transcriptional repressor Rex 1 (Gene Name=rex1)

[Back to BioLiP]