Structure of PDB 7wb2 Chain B |
>7wb2B (length=120) Species: 1969 (Streptomyces chartreusis) [Search protein sequence] |
HMAVELNHTIVLVKDKDASATFMADLLGLPKPKEMGPFAVLQLANDVSIL FMDFRDIVPGHCAFLISDEEFDQIFGRIREGGIEHWADQYHREPGRINDG RGVFFEDPSGHNMEIMTRPY |
|
PDB | 7wb2 Alteration of the Catalytic Reaction Trajectory of a Vicinal Oxygen Chelate Enzyme by Directed Evolution. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
B |
E4 D45 |
E5 D46 |
|
|
|
|