Structure of PDB 7vru Chain B

Receptor sequence

>7vruB (length=494) Species: 43263 (Pseudomonas alcaligenes)

EYQQHQASRLGKKKLEDLLWGAAEFLRGQIDASDYKQYIFPLLFYKRLSD
VYLEEYSENEGDASYAAMPMFHRFHIPQEARWEKVRDTRKNIGKAIQNAL
RLIETHNERLHGVFGDAQWTNKERLPDHLLADLIQHFSKIPLGIKSVAQD
DLGEAYEYLIKKFADDSGHTAAEFYTNRTVVHLMTRIMGLKPGETAYDPT
CGTGGMLLNAVMDLRNEGKEWRSVKLYGQEVNLLTSAIARMNMFLHEIEE
FEVLRGDTLAEPKFIEGDQLKQFDVIFANPPYSIKKWNRDKFAADPYGRN
LYGVPPQGCADYGFYTHIIKSLKPDTGRAAMLWPHGVLFRDSEQAIRKQV
IESDIIEAVIGLGPNLFYNSPMESCVVVLNCNKPAERKGKILFINGVEHV
TRERAHSRLSDDDLTVLIEAYSAPDKQPAITALVDIEVIRENQHNLSIPL
YVQAADNEEVHDIEHAIEAWKVSRVQLKKQTSKLFKSLAELGYE

3D structure

• PDB: 7vru Molecular insights into DNA recognition and methylation by non-canonical type I restriction-modification systems.
• Chain: B
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K15 H175 A178 F180 N285 Y288 S289 R346 F373 S376 M378 R410	K13 H169 A172 F174 N279 Y282 S283 R340 F367 S370 M372 R404
BS02	dna	B	W22 R29 K168 K291 P312 Q313 G314 S348 R408 R410 A411	W20 R27 K162 K285 P306 Q307 G308 S342 R402 R404 A405
BS03	SAH	B	A177 A178 F180 Y181 T182 D204 T206 C207 M212 E236 V237 D263 T264 N285 P287	A171 A172 F174 Y175 T176 D198 T200 C201 M206 E230 V231 D257 T258 N279 P281

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 19:26:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vru', asym_id = 'B', title = 'Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vru', asym_id='B', title='Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003676,0003677,0008168,0008170,0032259', uniprot = '', pdbid = '7vru', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0008168,0008170,0032259', uniprot='', pdbid='7vru', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>