Structure of PDB 7vrf Chain B

Receptor sequence
>7vrfB (length=60) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
SSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIAD
YEAELFQQSR
3D structure
PDB7vrf Structural insights into the chromodomain of Oxpecker in complex with histone H3 lysine 9 trimethylation reveal a transposon silencing mechanism by heterodimerization.
ChainB
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B S20 E21 Y22 I23 W43 Y46 Q50 E54 N58 K61 C62 T64 L65 S2 E3 Y4 I5 W25 Y28 Q32 E36 N40 K43 C44 T46 L47
External links