Structure of PDB 7vh1 Chain B

Receptor sequence

YGRYNCKCCWFADTNLITCNDHYLCLRCHQTMLRNSELCHICWKPLPTS

3D structure

PDB

7vh1 Structure of Machupo virus polymerase in complex with matrix protein Z.

Chain

Resolution

4.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C42 C61	C9 C28
BS02	ZN	B	H55 C72 I74 C75	H22 C39 I41 C42

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0015144	carbohydrate transmembrane transporter activity
GO:0046872	metal ion binding
GO:1901982	maltose binding

	Biological Process
GO:0006974	DNA damage response
GO:0008643	carbohydrate transport
GO:0015768	maltose transport
GO:0034219	carbohydrate transmembrane transport
GO:0034289	detection of maltose stimulus
GO:0039702	viral budding via host ESCRT complex
GO:0042956	maltodextrin transmembrane transport
GO:0046761	viral budding from plasma membrane
GO:0055085	transmembrane transport
GO:0060326	cell chemotaxis

	Cellular Component
GO:0016020	membrane
GO:0020002	host cell plasma membrane
GO:0030288	outer membrane-bounded periplasmic space
GO:0030430	host cell cytoplasm
GO:0042597	periplasmic space
GO:0043190	ATP-binding cassette (ABC) transporter complex
GO:0044220	host cell perinuclear region of cytoplasm
GO:0044423	virion component
GO:0055052	ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060	maltose transport complex

External links

PDB	RCSB:7vh1, PDBe:7vh1, PDBj:7vh1
PDBsum	7vh1
PubMed	34697302
UniProt	P0AEX9\|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE); Q6IUF9