Structure of PDB 7uxv Chain B

Receptor sequence

>7uxvB (length=247) Species: 9606 (Homo sapiens)

PSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFA
RQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHV
FGESDELIGQKVAHALAEGLRVIACIGEKLDEREAGITEKVVFEQTKVIA
DNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVA
QSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

3D structure

• PDB: 7uxv human triosephosphate isomerase mutant G122R
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Enzyme Commision number: 4.2.3.3: methylglyoxal synthase.
  5.3.1.1: triose-phosphate isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGA	B	K13 H95 S211 G232	K12 H94 S210 G231

Gene Ontology

Molecular Function

• GO:0004807 triose-phosphate isomerase activity
• GO:0005515 protein binding
• GO:0008929 methylglyoxal synthase activity
• GO:0016829 lyase activity
• GO:0016853 isomerase activity
• GO:0031625 ubiquitin protein ligase binding
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006094 gluconeogenesis
• GO:0006096 glycolytic process
• GO:0019242 methylglyoxal biosynthetic process
• GO:0019563 glycerol catabolic process
• GO:0019682 glyceraldehyde-3-phosphate metabolic process
• GO:0046166 glyceraldehyde-3-phosphate biosynthetic process
• GO:0061621 canonical glycolysis

Cellular Component

• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7uxv, PDBe:7uxv, PDBj:7uxv
• PDBsum: 7uxv
• UniProt: P60174|TPIS_HUMAN Triosephosphate isomerase (Gene Name=TPI1)