Structure of PDB 7uv9 Chain B

Receptor sequence
>7uv9B (length=78) Species: 9606 (Homo sapiens) [Search protein sequence]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFG
3D structure
PDB7uv9 Structural basis of paralog-specific KDM2A/B nucleosome recognition.
ChainB
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R45 K79 T80 R22 K56 T57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0032200 telomere organization
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uv9, PDBe:7uv9, PDBj:7uv9
PDBsum7uv9
PubMed36797403
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]