Structure of PDB 7umw Chain B

Receptor sequence

>7umwB (length=260) Species: 511145 (Escherichia coli str. K-12 substr. MG1655)

MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEE
FAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQL
DGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAE
RAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGI
KDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG
FSIAAMNELE

3D structure

• PDB: 7umw An Iterative Approach Guides Discovery of the FabI Inhibitor Fabimycin, a Late-Stage Antibiotic Candidate with In Vivo Efficacy against Drug-Resistant Gram-Negative Infections
• Chain: B
• Resolution: 1.54 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	G13 S19 I20 Q40 D64 V65 S91 I92 G93 L144 S145 K163 A189 P191 I192 T194 A196	G13 S19 I20 Q40 D64 V65 S91 I92 G93 L144 S145 K163 A189 P191 I192 T194 A196
BS02	NUC	B	F94 A95 L100 Y146 N155 Y156 A196 S198 I200 F203 M206	F94 A95 L100 Y146 N155 Y156 A196 S198 I200 F203 M206

Gene Ontology

Molecular Function

• GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0070404 NADH binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009102 biotin biosynthetic process
• GO:0030497 fatty acid elongation
• GO:0046677 response to antibiotic
• GO:0051289 protein homotetramerization

Cellular Component

• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:1902494 catalytic complex

External links

• PDB: RCSB:7umw, PDBe:7umw, PDBj:7umw
• PDBsum: 7umw
• PubMed: 36188352
• UniProt: P0AEK4|FABI_ECOLI Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (Gene Name=fabI)