Structure of PDB 7tv4 Chain B |
>7tv4B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] |
LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK ADFQAERQAREKLAEKKELLQEQLEQLQREY |
|
PDB | 7tv4 Structural basis for the simultaneous recognition of NEMO and acceptor ubiquitin by the HOIP NZF1 domain. |
Chain | B |
Resolution | 4.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
Q266 K277 |
Q7 K18 |
|
|
|