Structure of PDB 7ttw Chain B

Receptor sequence

>7ttwB (length=273) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

AIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTV
RHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEK
RYIIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKG
GQIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHE
LVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWG
KPTLGKKTRRGKKSSDKLIVRGR

3D structure

PDB

7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	P8 T10 N11 G12 R14 K31 K40 A41 G42 R43 N44 N45 Q46 K48 L49 T50 V51 R52 H58 K59 R60 Q61 Y62 R63 Y83 R87 G99 K147 K150 Q153 I154 A155 R156 S157 A158 R177 S178 E180 R182 H200 E201 V205 G206 K207 A208 G209 R210 S211 R212 W213 R217 P218 T219 V220 R221 S223 V224 M225 N228 D229 H232 E236 G237 R238 A239 P240 G242 R243 P244 P249 W250 T254 L255 G256 K257 K258 T259 R260 K263 R274	P7 T9 N10 G11 R13 K30 K39 A40 G41 R42 N43 N44 Q45 K47 L48 T49 V50 R51 H57 K58 R59 Q60 Y61 R62 Y82 R86 G98 K146 K149 Q152 I153 A154 R155 S156 A157 R176 S177 E179 R181 H199 E200 V204 G205 K206 A207 G208 R209 S210 R211 W212 R216 P217 T218 V219 R220 S222 V223 M224 N227 D228 H231 E235 G236 R237 A238 P239 G241 R242 P243 P248 W249 T253 L254 G255 K256 K257 T258 R259 K262 R273

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum	7ttw
PubMed	35736238
UniProt	P60430\|RL2_STAA8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]