Structure of PDB 7tmw Chain B

Receptor sequence

>7tmwB (length=298) Species: 9606 (Homo sapiens) [Search protein sequence]

GRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKV
HAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELA
GHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSL
SLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRAELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF
NCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

3D structure

PDB

7tmw The relaxin receptor RXFP1 signals through a mechanism of autoinhibition.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D333 G334 V337	D281 G282 V285

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0030159	signaling receptor complex adaptor activity
GO:0044877	protein-containing complex binding
GO:0051020	GTPase binding

	Biological Process
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway
GO:0007265	Ras protein signal transduction
GO:0008283	cell population proliferation
GO:0050909	sensory perception of taste
GO:0060041	retina development in camera-type eye
GO:0071380	cellular response to prostaglandin E stimulus
GO:0071870	cellular response to catecholamine stimulus

	Cellular Component
GO:0001750	photoreceptor outer segment
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005829	cytosol
GO:0005834	heterotrimeric G-protein complex
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0097381	photoreceptor disc membrane
GO:1903561	extracellular vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7tmw, PDBe:7tmw, PDBj:7tmw
PDBsum	7tmw
PubMed	37081311
UniProt	P62873\|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Gene Name=GNB1)

[Back to BioLiP]