Structure of PDB 7tjj Chain B

Receptor sequence

>7tjjB (length=251) Species: 4932 (Saccharomyces cerevisiae)

KSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNE
NFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDY
LSPKIAYSQLSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYW
GNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSV
IRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVM
K

3D structure

• PDB: 7tjj A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R254 T255 K258 R260 W396	R21 T22 K25 R27 W150
BS02	dna	B	K251 R373 R390 W396 H399	K18 R127 R144 W150 H153

Gene Ontology

Molecular Function

• GO:0003682 chromatin binding
• GO:0003688 DNA replication origin binding
• GO:0005515 protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
• GO:0006270 DNA replication initiation
• GO:0030466 silent mating-type cassette heterochromatin formation
• GO:0031509 subtelomeric heterochromatin formation

Cellular Component

• GO:0000781 chromosome, telomeric region
• GO:0000808 origin recognition complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005656 nuclear pre-replicative complex
• GO:0005664 nuclear origin of replication recognition complex
• GO:0031261 DNA replication preinitiation complex

External links

• PDB: RCSB:7tjj, PDBe:7tjj, PDBj:7tjj
• PDBsum: 7tjj
• PubMed: 35217664
• UniProt: P32833|ORC2_YEAST Origin recognition complex subunit 2 (Gene Name=ORC2)