Structure of PDB 7thw Chain B |
>7thwB (length=144) Species: 214092 (Yersinia pestis CO92) [Search protein sequence] |
LLGAWDNAYIAAAMPLLLLVENIRNAAEVRPPIVRELQYFQQHLQKKNYP QEDINHLSYLLCTYIDGIFNNQSLLVEFHRDAWGGEDCFEHLRVYMNSPK QYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYG |
|
PDB | 7thw Crystal Structure of the Soluble Domain of the Putative OmpA -Family Membrane Protein YPO0514 from Yersinia pestis |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
G138 D141 |
G3 D6 |
|
|
|