Structure of PDB 7t91 Chain B

Receptor sequence
>7t91B (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
TDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKA
QYMLVVHMRRHT
3D structure
PDB7t91 Crystal structure of Zinc finger motif 1 and 2 of GLI1 DNA binding region
ChainB
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C237 C242 H255 H260 C3 C8 H21 H26
BS02 ZN B C270 C275 H291 H295 C36 C41 H57 H61
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008270 zinc ion binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t91, PDBe:7t91, PDBj:7t91
PDBsum7t91
PubMed
UniProtP08151|GLI1_HUMAN Zinc finger protein GLI1 (Gene Name=GLI1)

[Back to BioLiP]