Structure of PDB 7t7l Chain B

Receptor sequence

>7t7lB (length=264) Species: 9606 (Homo sapiens)

IICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITH
LQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQA
CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGE
LISDAEADVREDDSYLFDLDGEVYCIDARYYGNISRFINHLCDPNIIPVR
VFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSE
KCKHSAEAIALEQS

3D structure

• PDB: 7t7l Discovery of the First-in-Class G9a/GLP Covalent Inhibitors.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C1017 C1023 C1027	C97 C103 C107
BS02	ZN	B	C974 C987 C1017 C1021	C54 C67 C97 C101
BS03	ZN	B	C974 C976 C980 C985	C54 C56 C60 C65
BS04	ZN	B	C1115 C1168 C1170 C1175	C192 C245 C247 C252
BS05	SAM	B	M1048 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168 Q1169	M128 W130 S164 Y165 R186 F187 N189 H190 Y231 F243 C245 Q246
BS06	G5U	B	Y1067 D1074 A1077 D1078 D1083 L1086 F1087 D1088 C1098 R1157 F1158 K1162	Y147 D154 A157 D158 D163 L166 F167 D168 C175 R234 F235 K239

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7t7l, PDBe:7t7l, PDBj:7t7l
• PDBsum: 7t7l
• PubMed: 35763668
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)