Structure of PDB 7sv9 Chain B

Receptor sequence

>7sv9B (length=102) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

NPYIYLGGAILAEVIGTTLMKFSNGFTRLIPSMGTIICYCASFWLLAQTL
AYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLII
NL

3D structure

PDB

7sv9 Crystal structures of bacterial small multidrug resistance transporter EmrE in complex with structurally diverse substrates.

Chain

Resolution

3.36 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	P4P	B	E14 Y40 S43 F44 Y60 W63	E13 Y39 S42 F43 Y59 W62

Gene Ontology

	Molecular Function
GO:0015199	amino-acid betaine transmembrane transporter activity
GO:0015220	choline transmembrane transporter activity
GO:0015297	antiporter activity
GO:0022857	transmembrane transporter activity
GO:0042802	identical protein binding
GO:0042910	xenobiotic transmembrane transporter activity

	Biological Process
GO:0006805	xenobiotic metabolic process
GO:0006970	response to osmotic stress
GO:0006974	DNA damage response
GO:0009410	response to xenobiotic stimulus
GO:0015871	choline transport
GO:0031460	glycine betaine transport
GO:0042908	xenobiotic transport
GO:0055085	transmembrane transport
GO:0071466	cellular response to xenobiotic stimulus
GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:1990207	EmrE multidrug transporter complex

External links

PDB	RCSB:7sv9, PDBe:7sv9, PDBj:7sv9
PDBsum	7sv9
PubMed	35254261
UniProt	P23895\|EMRE_ECOLI Multidrug transporter EmrE (Gene Name=emrE)