Structure of PDB 7ssf Chain B

Receptor sequence

>7ssfB (length=175) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

DAFSKVITSADGKAAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASCIV
SDSVSGMVCENPSLIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSGDS
SVLEDRCLNGLKETYASLGVPAAGNARTISIMKATVIGFITNNSQQKKLS
TPAGDCSALASEVGGYFDKVSSALA

3D structure

PDB

7ssf Phaser crystallographic software.

Chain

Resolution

1.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AX9	B	C50 D54 G58 C61 R129 I133 A136 T137 F141 S146 Q148	C48 D52 G56 C59 R127 I131 A134 T135 F139 S144 Q146
BS02	PEB	B	M59 G72 V73 K78 A81 C82 R84 D85 I88 L120 V122 P123 N127 T130	M57 G70 V71 K76 A79 C80 R82 D83 I86 L118 V120 P121 N125 T128
BS03	PEB	B	L24 K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158	L22 K26 N33 K34 M36 D37 I140 N142 T151 P152 A153 G154 C156

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ssf, PDBe:7ssf, PDBj:7ssf
PDBsum	7ssf
PubMed
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]