Structure of PDB 7shi Chain B

Receptor sequence

>7shiB (length=391) Species: 40318 (Streptomyces nodosus)

PPPSLEDAAPSVLRLSPLLRELQMRAPVTKIRTPAGDEGWLVTRHAELKQ
LLHDERLARAHADPANAPRYVKSPLMDLLIMDDVEAARAAHAELRTLLTP
QFSARRVLNMMPMVEGIAEQILNGFAAQEQPADLRGNFSLPYSLTVLCAL
IGIPLQEQGQLLAVLGEMATLNDAESVARSQAKLFGLLTDLAGRKRAEPG
DDVISRLCETVPEDERIGPIAASLLFAGLDSVATHVDLGVVLFTQYPDQL
KEALADEKLMRSGVEEILRAAKAGGSGAALPRYATDDIEIADVTIRTGDL
VLLDFTLVNFDEAVFDDADLFDIRRSPNEHLTFGHGMWHCIGAPLARMML
KTAYTQLFTRLPGLKLASSVEELQVTSGQLNGGLTELPVTW

3D structure

• PDB: 7shi Structural analysis of P450 AmphL from Streptomyces nodosus provides insights into substrate selectivity of polyene macrolide antibiotic biosynthetic P450s.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	R64 H96 R100 F107 A232 G233 S236 V237 H240 R287 F310 T337 F338 C345 G347	R59 H91 R95 F102 A227 G228 S231 V232 H235 R282 F305 T332 F333 C340 G342
BS02	4UH	B	D12 L80 L83 L84 S228 F231 A232 K277 G282 A283 A284 L285 T311 Q384 L385 N386	D7 L75 L78 L79 S223 F226 A227 K272 G277 A278 A279 L280 T306 Q379 L380 N381

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0008395 steroid hydroxylase activity
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0036199 cholest-4-en-3-one 26-monooxygenase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006707 cholesterol catabolic process

External links

• PDB: RCSB:7shi, PDBe:7shi, PDBj:7shi
• PDBsum: 7shi
• PubMed: 35189143
• UniProt: Q93NX6