Structure of PDB 7ros Chain B

Receptor sequence

>7rosB (length=356) Species: 36329 (Plasmodium falciparum 3D7)

KAQEESKIEDVDKILNDILSISSECIQPDELRVKLLLKRKLICYDGFEPS
GRMHIAQGLLKSIIVNKLTSNGCTFIFWIADWFAHLNNKMSGDLKKIKKV
GSYFIEVWKSCGMNMENVQFLWASEEINKKPNEYWSLVLDISRSFNINRM
KRCLKIMGRSEGEENYCSQILYPCMQCADIFFLNVDICQLGIDQRKVNML
AREYCDIKKIKKKPVILSHGMLPGLLEGQEKMSKSDENSAIFMDDSESDV
NRKIKKAYCPPNVIENNPIYAYAKSIIFPSYNEFNLVRKEKNGGDKTYYT
LQELEHDYVNGFIHPLDLKDNVAMYINKLLQPVRDHFQNNIEAKNLLNEI
KKYKVT

3D structure

• PDB: 7ros Reaction hijacking of tyrosine tRNA synthetase as a new whole-of-life-cycle antimalarial strategy.
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Enzyme Commision number: 6.1.1.1: tyrosine--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	66I	B	Y60 D61 G62 F63 E64 H70 A72 W94 F99 I172 Y188 Q192 D195 L206 G207 D209 Q210 H235 M237 L238 K247 M248 S249	Y44 D45 G46 F47 E48 H54 A56 W78 F83 I156 Y172 Q176 D179 L190 G191 D193 Q194 H219 M221 L222 K231 M232 S233
BS02	MG	B	M131 V134	M115 V118

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0004831 tyrosine-tRNA ligase activity
• GO:0005524 ATP binding
• GO:0046789 host cell surface receptor binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0006418 tRNA aminoacylation for protein translation
• GO:0006437 tyrosyl-tRNA aminoacylation
• GO:0044650 adhesion of symbiont to host cell

Cellular Component

• GO:0005737 cytoplasm
• GO:0044164 host cell cytosol

External links

• PDB: RCSB:7ros, PDBe:7ros, PDBj:7ros
• PDBsum: 7ros
• PubMed: 35653481
• UniProt: Q8IAR7