Structure of PDB 7rgj Chain B

Receptor sequence

>7rgjB (length=157) Species: 562 (Escherichia coli)

MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFES
MGALPNRKYAVVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGG
EIYKSLIDQVDTLHISTIDIEPEGDVYFPEIPSNFRPVFTQDFASNINYS
YQIWQKG

3D structure

• PDB: 7rgj Structure-guided functional studies of plasmid-encoded dihydrofolate reductases reveal a common mechanism of trimethoprim resistance in Gram-negative pathogens.
• Chain: B
• Resolution: 1.44 Å

Enzymatic activity

• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	V7 A8 I15 G18 P19 D20 I21 G44 R45 K46 T47 V62 T63 R64 S79 G99 G100 E101 I102	V7 A8 I15 G18 P19 D20 I21 G44 R45 K46 T47 V62 T63 R64 S79 G99 G100 E101 I102
BS02	CA	B	S79 I80 K81	S79 I80 K81
BS03	560	B	M6 V7 A8 E28 Q29 F32 K33 S50 M51 L54	M6 V7 A8 E28 Q29 F32 K33 S50 M51 L54
BS04	8MU	B	W40 L75 I76 F77 N86 I90	W40 L75 I76 F77 N86 I90

Gene Ontology

Molecular Function

• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0031427 response to methotrexate
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process
• GO:0046677 response to antibiotic

External links

• PDB: RCSB:7rgj, PDBe:7rgj, PDBj:7rgj
• PDBsum: 7rgj
• PubMed: 35562546
• UniProt: P00382|DYR1_ECOLX Dihydrofolate reductase type 1 (Gene Name=dhfrI)