Structure of PDB 7re5 Chain B |
>7re5B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] |
SHMCSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDD YSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGID EIYLESCCQA |
|
PDB | 7re5 Pentameric assembly of the Kv2.1 tetramerization domain. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H105 C132 |
H80 C107 |
|
BS02 |
ZN |
B |
H27 C29 |
H2 C4 |
|
|
|
|