Structure of PDB 7r97 Chain B

Receptor sequence

>7r97B (length=226) Species: 83333 (Escherichia coli K-12)

MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNARLEFLGDSILSY
VIANALYHRFPRVDAGDMSRMRATLVRGNTLAELAREFELGECLRLGPGE
LKSGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTRLDEISPG
DKQKDPKTRLQEYLAGRHLPLPTYLVVQVRGEAHDQEFTIHCQVSGLSEP
VVGTGSSRRKAEQAAAEQALKKLELE

3D structure

• PDB: 7r97 Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
• Chain: B
• Resolution: 1.804 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.3: ribonuclease III.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	D45 G66 S69 A73 R77 K154 D155 K157 T158 Q161 E162 H168	D45 G66 S69 A73 R77 K154 D155 K157 T158 Q161 E162 H168
BS02	rna	B	H29 R30 S31 D45 G99 E100 K102 R108 S110 E117 A183 H184 Q186 R208 R209	H29 R30 S31 D45 G99 E100 K102 R108 S110 E117 A183 H184 Q186 R208 R209
BS03	MG	B	E41 E117	E41 E117
BS04	MG	B	D45 E117	D45 E117

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0003725 double-stranded RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0004525 ribonuclease III activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0019843 rRNA binding
• GO:0019899 enzyme binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing
• GO:0010468 regulation of gene expression

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7r97, PDBe:7r97, PDBj:7r97
• PDBsum: 7r97
• PubMed: 35829618
• UniProt: P0A7Y0|RNC_ECOLI Ribonuclease 3 (Gene Name=rnc)