Structure of PDB 7r8e Chain B

Receptor sequence
>7r8eB (length=548) Species: 9606 (Homo sapiens) [Search protein sequence]
RAAVNIEFRDLSYSVPEKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI
LAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV
SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALE
LVNNPPVMFFDQPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKL
FELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVAS
GEYGDQNSRLVRAVREGSASCLTQFCILFKRTFLSIMRDSVLTHLRITSH
IGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLE
MGVFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSD
AVRFVLFAALGTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFS
GFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCH
FQKSEAILRELDVENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAER
3D structure
PDB7r8e Molecular basis of cholesterol efflux via ABCG subfamily transporters.
ChainB
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.6.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B S216 S218 S136 S138
BS02 ATP B S120 G121 G123 K124 S125 T126 S40 G41 G43 K44 S45 T46
BS03 MG B Q164 Q242 Q84 Q162
BS04 CLR B Y592 L638 V642 F646 Y474 L520 V524 F528
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005543 phospholipid binding
GO:0015485 cholesterol binding
GO:0016887 ATP hydrolysis activity
GO:0019534 toxin transmembrane transporter activity
GO:0034041 ABC-type sterol transporter activity
GO:0042803 protein homodimerization activity
GO:0043531 ADP binding
GO:0046982 protein heterodimerization activity
GO:0046983 protein dimerization activity
GO:0090554 phosphatidylcholine floppase activity
GO:0120020 cholesterol transfer activity
GO:0140328 floppase activity
GO:0140359 ABC-type transporter activity
Biological Process
GO:0006869 lipid transport
GO:0008203 cholesterol metabolic process
GO:0010745 negative regulation of macrophage derived foam cell differentiation
GO:0010875 positive regulation of cholesterol efflux
GO:0010887 negative regulation of cholesterol storage
GO:0010888 negative regulation of lipid storage
GO:0030301 cholesterol transport
GO:0032367 intracellular cholesterol transport
GO:0033344 cholesterol efflux
GO:0033700 phospholipid efflux
GO:0033993 response to lipid
GO:0034204 lipid translocation
GO:0034374 low-density lipoprotein particle remodeling
GO:0034375 high-density lipoprotein particle remodeling
GO:0034436 glycoprotein transport
GO:0042632 cholesterol homeostasis
GO:0042987 amyloid precursor protein catabolic process
GO:0043691 reverse cholesterol transport
GO:0045542 positive regulation of cholesterol biosynthetic process
GO:0050714 positive regulation of protein secretion
GO:0055085 transmembrane transport
GO:0055091 phospholipid homeostasis
GO:0071403 cellular response to high density lipoprotein particle stimulus
GO:0090181 regulation of cholesterol metabolic process
GO:1902004 positive regulation of amyloid-beta formation
Cellular Component
GO:0000139 Golgi membrane
GO:0005739 mitochondrion
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0055037 recycling endosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r8e, PDBe:7r8e, PDBj:7r8e
PDBsum7r8e
PubMed34404721
UniProtP45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 (Gene Name=ABCG1)

[Back to BioLiP]