Structure of PDB 7r0w Chain B

Receptor sequence
>7r0wB (length=159) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
SIIKKPDLSDPDLRAKLAKGMGHNYYGEPAWPNDILYMFPICILGALGLI
AGLAILDPAMIGEPADPFATPLEILPEWYLYPTFQILRILPNKLLGIAGM
AAIPLGLMLVPFIESVNKFQNPFRRPIAMTVFLFGTAAALWLGAGATFPI
DKSLTLGLF
3D structure
PDB7r0w Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B D35 M39 G49 L50 G53 L57 D34 M38 G48 L49 G52 L56
BS02 HEM B F40 C43 I44 F39 C42 I43
BS03 CLA B Y80 P83 P105 L106 L108 V132 F133 G136 A140 Y79 P82 P104 L105 L107 V131 F132 G135 A139
BS04 2WA B A138 L141 T148 A137 L140 T147
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r0w, PDBe:7r0w, PDBj:7r0w
PDBsum7r0w
PubMed35726684
UniProtP27589|PETD_SYNY3 Cytochrome b6-f complex subunit 4 (Gene Name=petD)

[Back to BioLiP]