Structure of PDB 7qhr Chain B

Receptor sequence

>7qhrB (length=124) Species: 9913 (Bos taurus)

KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEGNPYVPVHFDASV

3D structure

• PDB: 7qhr Unexpected Imidazole Coordination to the Dirhodium Center in a Protein Environment: Insights from X-ray Crystallography and Quantum Chemistry.
• Chain: B
• Resolution: 1.4 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	D1O	B	K7 Q11 V118 H119	K7 Q11 V118 H119

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:7qhr, PDBe:7qhr, PDBj:7qhr
• PDBsum: 7qhr
• PubMed: 35609175
• UniProt: P61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)