Structure of PDB 7qfw Chain B

Receptor sequence
>7qfwB (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
FEKDLMAYFDENLNRNWRGREHWKVRNVLEIDFFKTDDSFEDKVFASKGR
TKIDMPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPAQKMSLFS
3D structure
PDB7qfw A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
ChainB
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T481 K482 T51 K52
BS02 dna B R400 R411 R480 R15 R26 R50
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0007076 mitotic chromosome condensation
GO:0030261 chromosome condensation
GO:0051301 cell division
GO:0070058 tRNA gene clustering
Cellular Component
GO:0000796 condensin complex
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qfw, PDBe:7qfw, PDBj:7qfw
PDBsum7qfw
PubMed35653469
UniProtP38170|CND2_YEAST Condensin complex subunit 2 (Gene Name=BRN1)

[Back to BioLiP]