Structure of PDB 7qbt Chain B

Receptor sequence

>7qbtB (length=408) Species: 2214 (Methanosarcina acetivorans)

MEVVVDVGGNPGVDCKGFCKYCYFKKVKDIQPLGCKYCLPFKKGCDYCTR
SVKESYSGFKSLQMVLEETANKLYFTEVKKFTVSGGGDLSCYPELKSLIT
FLSQFNTPIHLGYTSGKGFSKPDDALFYIDNGVTEVSFTVFATDPALRAE
YMKDPEPEASIQVLRDFCTHCEVYGAIVLLPGINDGEVLEKTLCDLENMG
AKGAILMRFANFQENGLILNNSPIIPGITPHTVSEFTEIVRSSAEKHPSI
RITGTPLEDPLIGSPFAIRNVPEALLKLPRVSKKATIITGQVAASRLTEI
FEALGGTVNVIPVKKDIGCLITIDDFKALDLSEVTETVFIPGRAFVHDME
IKEALRRDGVDRIVRRGPERLSVDGEMSIGMTREEVLELEVENFTELIGQ
INSLGLPL

3D structure

• PDB: 7qbt Crystallographic snapshots of a B 12 -dependent radical SAM methyltransferase.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.379: [methyl coenzyme M reductase]-L-arginine C-5-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	P11 G12 C15 F18 C19 C22 Y115 S117 K119	P11 G12 C15 F18 C19 C22 Y113 S115 K117
BS02	FE	B	C35 C38 C45 C48	C35 C38 C45 C48
BS03	MTA	B	Y21 Y23 Y115 V180 M209 F211 A212	Y21 Y23 Y113 V178 M207 F209 A210
BS04	COB	B	Y23 F24 Y47 R210 A212 N217 L219 I220 L221 N223 P258 F268 I289 T291 D318 I319 G320 C321 L322 F341 I342 P343 R345 F347 G369 P370 E371 R372 L373 S374 D376 E378	Y23 F24 Y47 R208 A210 N215 L217 I218 L219 N221 P256 F266 I287 T289 D316 I317 G318 C319 L320 F339 I340 P341 R343 F345 G367 P368 E369 R370 L371 S372 D374 E376

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008168 methyltransferase activity
• GO:0035244 protein-arginine C-methyltransferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0032259 methylation
• GO:0043687 post-translational protein modification

External links

• PDB: RCSB:7qbt, PDBe:7qbt, PDBj:7qbt
• PDBsum: 7qbt
• PubMed: 35110733
• UniProt: Q8THG6|MCRAM_METAC [Methyl coenzyme M reductase]-L-arginine C-5-methyltransferase (Gene Name=MA_4551)