Structure of PDB 7qa8 Chain B

Receptor sequence

>7qa8B (length=299) Species: 4932 (Saccharomyces cerevisiae)

APSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIM
FGVRCGAAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLS
NYSSVTYALTGFPQFISRGDVHVYGATNIIQVLLVASIETSLVFQIKVIF
TGDNFKRIGLMLTSISFTLGIATVTMYFVSAVKGMIVTYNDVSATQDKYF
NASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQFDSFHILLIMSCQS
LLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAANNAS

3D structure

• PDB: 7qa8 Activation mechanism of the class D fungal GPCR dimer Ste2.
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	H94 Y98 Y101 Y106 Y128 T131 N132 S184 A185 T199 D201 F204 N205 T274 D275	H90 Y94 Y97 Y102 Y124 T127 N128 S180 A181 T195 D197 F200 N201 T270 D271
BS02	Y01	B	A63 K100	A59 K96
BS03	Y01	B	H126 Y193	H122 Y189
BS04	Y01	B	T172 M180	T168 M176
BS05	Y01	B	L247 S251 L291	L243 S247 L287
BS06	Y01	B	T72 R74 L287 L291	T68 R70 L283 L287
BS07	Y01	B	R122 H126	R118 H122
BS08	Y01	B	W70 M71 F89	W66 M67 F85
BS09	Y01	B	W70 R76 K77 V86 F89	W66 R72 K73 V82 F85
BS10	Y01	B	N216 Y266	N212 Y262
BS11	Y01	B	Q272 G273 L277	Q268 G269 L273

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004932 mating-type factor pheromone receptor activity
• GO:0004934 mating-type alpha-factor pheromone receptor activity
• GO:0005515 protein binding

Biological Process

• GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
• GO:0000755 cytogamy
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0019236 response to pheromone

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0038038 G protein-coupled receptor homodimeric complex

External links

• PDB: RCSB:7qa8, PDBe:7qa8, PDBj:7qa8
• PDBsum: 7qa8
• PubMed: 35296853
• UniProt: D6VTK4|STE2_YEAST Pheromone alpha factor receptor (Gene Name=STE2)