Structure of PDB 7q9l Chain B |
>7q9lB (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL LSPYSYSTTAVVTNP |
|
PDB | 7q9l Transthyretin Binding Mode Dichotomy of Fluorescent trans -Stilbene Ligands. |
Chain | B |
Resolution | 1.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9RJ |
B |
K15 L17 L110 |
K5 L7 L100 |
|
|
|
|