Structure of PDB 7q4o Chain B

Receptor sequence
>7q4oB (length=124) Species: 9606 (Homo sapiens) [Search protein sequence]
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFK
RKYLQGKRGIEKPPFELPDFIKRTGIQEMRIDYQKLHDAFFKWQTKPKLT
IHGDLYYEGKEFEDRTPWGELEPS
3D structure
PDB7q4o Structural basis of branch site recognition by the human spliceosome.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B R459 T481 W504 R2 T24 W47
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q4o, PDBe:7q4o, PDBj:7q4o
PDBsum7q4o
PubMed34822310
UniProtQ13435|SF3B2_HUMAN Splicing factor 3B subunit 2 (Gene Name=SF3B2)

[Back to BioLiP]