Structure of PDB 7q2x Chain B

Receptor sequence

>7q2xB (length=388) Species: 559292 (Saccharomyces cerevisiae S288C)

QLSPVKNSRVELQKIYDRHQSRLFINELVLENFKSYAGKQVVGPFHTSFS
AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCS
VAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTE
VTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII
GTANYKPLIEERMGQIENLVQKRDEVKEQLGILKKKRFDEFMAGFNIISM
TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGG
EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA
QFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDI

3D structure

• PDB: 7q2x Clamping of DNA shuts the condensin neck gate.
• Chain: B
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R205 L214 S268 S278	R74 L83 S137 S147
BS02	ADP	B	K1315 R1318 N1322 S1324	K289 R292 N296 S298
BS03	BEF	B	S1324 G1325 G1326 A1356	S298 G299 G300 A330
BS04	ADP	B	K165 G188 S189 G190 K191 S192 N193 Q211 D216 K220	K34 G57 S58 G59 K60 S61 N62 Q80 D85 K89
BS05	BEF	B	N187 K191 Q302	N56 K60 Q171
BS06	MG	B	S192 Q302	S61 Q171

Gene Ontology

Molecular Function

• GO:0003682 chromatin binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0000070 mitotic sister chromatid segregation
• GO:0007059 chromosome segregation
• GO:0007076 mitotic chromosome condensation
• GO:0030261 chromosome condensation
• GO:0051276 chromosome organization
• GO:0051301 cell division
• GO:0070058 tRNA gene clustering
• GO:0070550 rDNA chromatin condensation

Cellular Component

• GO:0000796 condensin complex
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005737 cytoplasm

External links

• PDB: RCSB:7q2x, PDBe:7q2x, PDBj:7q2x
• PDBsum: 7q2x
• PubMed: 35349345
• UniProt: Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 (Gene Name=SMC4)