Structure of PDB 7pkt Chain B

Receptor sequence

>7pktB (length=128) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

PQIHAHDKYKKENPQPANSFLLGRFVTDRNGIIWHRQANYRHARHAKSAS
QLTRLKRWKPLAPAFAAKLRKLGFSERYWAAPDPQDVPGFHSPRGRVERP
RRSAVPDMDHTTGEPALRQSWQPPNRQR

3D structure

PDB

7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	B	P22 Q23 H25 K29	P1 Q2 H4 K8
BS02	rna	B	Q36 K92 G94 R98	Q15 K71 G73 R77
BS03	rna	B	N34 P35 P37 A85 K89 K92 P136 Q140 S141 W142 R147	N13 P14 P16 A64 K68 K71 P115 Q119 S120 W121 R126
BS04	rna	B	I53 I54 L82 P84 A87 R91 K92	I32 I33 L61 P63 A66 R70 K71
BS05	rna	B	R45 Q58 A59 N60 R62 H63 A67 A70 Q72 T74 R75 L76 K77 K80 R117 V118 A125 V126 S141 Q143 N146 R147	R24 Q37 A38 N39 R41 H42 A46 A49 Q51 T53 R54 L55 K56 K59 R96 V97 A104 V105 S120 Q122 N125 R126
BS06	rna	B	R57 R65 H66 R120 P121 R123 M129	R36 R44 H45 R99 P100 R102 M108

External links