Structure of PDB 7pji Chain B

Receptor sequence

>7pjiB (length=443) Species: 287 (Pseudomonas aeruginosa)

MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMD
TVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETAIVRDPVTV
TPSTKIIELLQMAREYGFSGFPVVEQGELVGIVTGRDLRVKPNAGDTVAA
IMTPKDKLVTAREGTPLEEMKAKLYENRIEKMLVVDENFYLRGLVTFRDI
EKAKTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAH
GHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGP
GSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAM
VAGAYCVMMGSMFAGTEEAPGYKSYRGMGPEGIEGRVPYKGALSAIVHQL
MGGLRAAMGYTGSADIQQMRTQPQFVRITGAGMAESHVHDVQI

3D structure

• PDB: 7pji Diversity of mechanisms to control bacterial GTP homeostasis by the mutually exclusive binding of adenine and guanine nucleotides to IMP dehydrogenase.
• Chain: B
• Resolution: 1.65 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	T134 R136 D137 T153 L158 V159 I179 E180 K181	T134 R136 D137 T153 L158 V159 I179 E180 K181
BS02	GDP	B	K88 P97 V98 F118 S119 G120 R198 D199	K88 P97 V98 F118 S119 G120 R198 D199
BS03	IMP	B	M49 G301 S302 I303 C304 D337 S361 Y384 G386 M387 G388 E417	M49 G301 S302 I303 C304 D337 S361 Y375 G377 M378 G379 E381

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0005524 ATP binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006177 GMP biosynthetic process
• GO:0006183 GTP biosynthetic process

External links

• PDB: RCSB:7pji, PDBe:7pji, PDBj:7pji
• PDBsum: 7pji
• PubMed: 35481629
• UniProt: A0A069Q6I8