Structure of PDB 7pel Chain B

Receptor sequence

>7pelB (length=278) Species: 33747 (Simian T-lymphotropic virus 1)

SPAKLHSFTHCGQAALTLHGATTTEALNILHSCHACRKNNPQHQMPRGHI
RRGLLPNHIWQGDITHFKYKNTLYRLHVWVDTFSGSVSATHKKRETSSEA
ISSLLHAIAHLGRPSHINTDNGPAYASQEFQHACTSLAIRHTTHIPYNPT
SSGLVERTNGILKTLLYKYFSDNPNLPMDNALSVALWTINHLNVLTHCQK
TRWQLHHSPRLPPIPEAKPVTTSKTHWYYFKIPGLNSRQWKGPQRALQEA
AGAALIPVSDTAAQWIPWKLLKRAVCPR

3D structure

• PDB: 7pel Cryo-EM structure of the deltaretroviral intasome in complex with the PP2A regulatory subunit B56gamma.
• Chain: B
• Resolution: 3.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	G50 H51 R53 R54 T144 H146 I147 T152 S153 G155 L156 R159 T198 R204 Q250 A252 A253 G254 W267	G48 H49 R51 R52 T142 H144 I145 T150 S151 G153 L154 R157 T196 R202 Q248 A250 A251 G252 W265
BS02	dna	B	P151 E158	P149 E156
BS03	dna	B	R39 N42 Q44 Q46	R37 N40 Q42 Q44
BS04	dna	B	T25 T26 P43 R49	T23 T24 P41 R47
BS05	ZN	B	H8 H12 C35 C38	H6 H10 C33 C36

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:7pel, PDBe:7pel, PDBj:7pel
• PDBsum: 7pel
• PubMed: 33028863
• UniProt: Q4QY51