Structure of PDB 7p3q Chain B

Receptor sequence
>7p3qB (length=147) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence]
MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETCSLMVVK
RSGVTEPFSRTKVINGVRKACQGRPVTEDALAQLGQRVEEAVRATGSAEL
TTHDVGLAILGPLQELDLVAYLRFASVYRAFDSLEDFEAAIAELRET
3D structure
PDB7p3q A nucleotide-sensing oligomerization mechanism that controls NrdR-dependent transcription of ribonucleotide reductases.
ChainB
Resolution3.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B V48 K50 R51 E56 F58 S59 K62 T102 F124 V48 K50 R51 E56 F58 S59 K62 T102 F124
BS02 DTP B K50 K62 G66 K69 R123 F124 V127 Y128 K50 K62 G66 K69 R123 F124 V127 Y128
BS03 ZN B C3 C6 C31 C3 C6 C31
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7p3q, PDBe:7p3q, PDBj:7p3q
PDBsum7p3q
PubMed35577776
UniProtO69980|NRDR_STRCO Transcriptional repressor NrdR (Gene Name=nrdR)

[Back to BioLiP]