Structure of PDB 7owr Chain B

Receptor sequence

>7owrB (length=391) Species: 9606 (Homo sapiens)

AKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQG
FTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPG
WLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLR
SKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRK
LIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTR
YLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPS
TIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDL
MENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 7owr Structural and Large-scale Analysis Unveil the Intertwined Paths Promoting NMT-catalyzed Lysine and Glycine Myristoylation.
• Chain: B
• Resolution: 2.39 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D183 D185 F188 R189 F190 Y192 I245 N246 Y281 T282 Y296 H298 F311 Y401 S405 Y420 G470 D471 Q496	D78 D80 F83 R84 F85 Y87 I140 N141 Y176 T177 Y191 H193 F206 Y296 S300 Y315 G365 D366 Q391
BS02	MYA	B	R115 Y117 F119 W120 Y180 V181 I245 L248 V250 R255 S256 R258 A260 T268 Q278 A279 Y281 T282 L287 Y479	R10 Y12 F14 W15 Y75 V76 I140 L143 V145 R150 S151 R153 A155 T163 Q173 A174 Y176 T177 L182 Y374

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:7owr, PDBe:7owr, PDBj:7owr
• PDBsum: 7owr
• PubMed: 36181773
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)