Structure of PDB 7owo Chain B

Receptor sequence

>7owoB (length=389) Species: 9606 (Homo sapiens)

PAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQ
GFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPP
GWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKL
RSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPR
KLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLT
RYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLP
STIMNHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLME
NKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 7owo Structural and Large-scale Analysis Unveil the Intertwined Paths Promoting NMT-catalyzed Lysine and Glycine Myristoylation.
• Chain: B
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	V181 E182 D183 F188 R189 F190 A283 G284 Y296 H298 F311 S405 G470 D471 N473	V77 E78 D79 F84 R85 F86 A179 G180 Y192 H194 F207 S301 G363 D364 N366
BS02	MYA	B	Y117 Q118 F119 W120 Y180 V181 I245 N246 L248 C249 V250 R255 S256 R258 A260 P261 T268 A279 Y281 T282 Y479	Y13 Q14 F15 W16 Y76 V77 I141 N142 L144 C145 V146 R151 S152 R154 A156 P157 T164 A175 Y177 T178 Y372

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:7owo, PDBe:7owo, PDBj:7owo
• PDBsum: 7owo
• PubMed: 36181773
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)