Structure of PDB 7oub Chain B

Receptor sequence
>7oubB (length=173) Species: 9606 (Homo sapiens) [Search protein sequence]
GPQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATF
FYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHV
AHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCL
RIPRSDVMYTDWKKDKCEPLEKQ
3D structure
PDB7oub The structural basis for high affinity binding of alpha 1-acid glycoprotein to the potent antitumor compound UCN-01.
ChainB
Resolution1.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UCN B Y27 Y37 V41 F49 L62 E64 L79 V88 R90 A99 F112 Y127 Y29 Y39 V43 F51 L64 E66 L81 V90 R92 A101 F114 Y129
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0002682 regulation of immune system process
GO:0006953 acute-phase response
GO:0032731 positive regulation of interleukin-1 beta production
GO:0032732 positive regulation of interleukin-1 production
GO:0032760 positive regulation of tumor necrosis factor production
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0031093 platelet alpha granule lumen
GO:0035578 azurophil granule lumen
GO:0035580 specific granule lumen
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oub, PDBe:7oub, PDBj:7oub
PDBsum7oub
PubMed34758357
UniProtP19652|A1AG2_HUMAN Alpha-1-acid glycoprotein 2 (Gene Name=ORM2)

[Back to BioLiP]