Structure of PDB 7om5 Chain B |
>7om5B (length=125) Species: 9844 (Lama glama) [Search protein sequence] |
QVQLQESGGGSVQAGGSLKLSCAASGRSFSTYAMGWFRQAPGQDREFVAT ISWTDSTDYADSVKGRFTISRDNAKNTGYLQMNSLKPEDTAVYYCAADRW ASSRRNVDYDYWGQGTQVTVSSHGS |
|
PDB | 7om5 Structural insights into the non-inhibitory mechanism of the anti-EGFR EgB4 nanobody. |
Chain | B |
Resolution | 1.48 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
D98 D110 |
D98 D110 |
|
|
|