Structure of PDB 7okp Chain B

Receptor sequence

>7okpB (length=344) Species: 10090 (Mus musculus)

RSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDF
KDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTD
RIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSG
NMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDE
YFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGL
VHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDT
LSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYT

3D structure

• PDB: 7okp Structural Studies Provide New Insights into the Role of Lysine Acetylation on Substrate Recognition by CARM1 and Inform the Design of Potent Peptidomimetic Inhibitors.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.319: type I protein arginine methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q149 F153 Y154 Q159 N162 M163 D166 E258 M260 Y262 N266 E267 H415 Y417 P473 F475	Q15 F19 Y20 Q25 N28 M29 D32 E124 M126 Y128 N132 E133 H281 Y283 P339 F341
BS02	QVR	B	Y150 F151 Y154 G193 E215 A216 K242 V243 E244 E258 M269	Y16 F17 Y20 G59 E81 A82 K108 V109 E110 E124 M135

Gene Ontology

Molecular Function

• GO:0016274 protein-arginine N-methyltransferase activity

Biological Process

• GO:0018216 peptidyl-arginine methylation

External links

• PDB: RCSB:7okp, PDBe:7okp, PDBj:7okp
• PDBsum: 7okp
• PubMed: 34569136
• UniProt: Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 (Gene Name=Carm1)